PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0023s0210.1
Common NameMTR_0023s0210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 84aa    MW: 9910.46 Da    PI: 10.5868
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0023s0210.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-18956148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT eEd ll+ +++++G g W++++r+ g++R++k+c++rw++yl
  Medtr0023s0210.1  9 KGTWTNEEDNLLKACINKYGQGKWHLVPRRAGLNRCRKSCRLRWFNYL 56
                      799********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.422460IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-19755IPR009057Homeodomain-like
SMARTSM007178.0E-16858IPR001005SANT/Myb domain
PfamPF002496.3E-17956IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-201082IPR009057Homeodomain-like
CDDcd001678.30E-111156No hitNo description
Gene3DG3DSA:1.10.10.607.2E-55682IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MDNTSGVKKG TWTNEEDNLL KACINKYGQG KWHLVPRRAG LNRCRKSCRL RWFNYLNPTI  60
NKERFSEDEV DMILRLQKLL KNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W2e-11780476Pre-mRNA-splicing factor cdc5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1995628e-56KM199562.1 Trifolium repens isolate Tr_RED_LEAF_DIFFUSEa R2R3 MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013443301.13e-56myb transcription factor
SwissprotQ9FNV95e-35MY113_ARATH; Transcription factor MYB113
TrEMBLA0A072TJG34e-56A0A072TJG3_MEDTR; Myb transcription factor
STRINGGLYMA09G36983.16e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.13e-36myb domain protein 113
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]